PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G10200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 555aa    MW: 59278.6 Da    PI: 6.7438
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G10200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.55.7e-33220276259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  +++++ei+Y+g+Hnh 
  OGLUM06G10200.1 220 DDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-EGQITEIVYKGTHNHA 276
                      8****************************************.***************7 PP

2WRKY105.92.1e-33384442159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct+agCpv+k+ver+++d ++v++tYeg+Hnh+
  OGLUM06G10200.1 384 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTAGCPVRKHVERASHDLRAVITTYEGKHNHD 442
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.3E-28212278IPR003657WRKY domain
PROSITE profilePS5081122.905214278IPR003657WRKY domain
SuperFamilySSF1182905.49E-25215278IPR003657WRKY domain
SMARTSM007741.7E-35219277IPR003657WRKY domain
PfamPF031064.4E-25220275IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-37369444IPR003657WRKY domain
SuperFamilySSF1182901.83E-29376444IPR003657WRKY domain
PROSITE profilePS5081138.687379444IPR003657WRKY domain
SMARTSM007741.2E-38384443IPR003657WRKY domain
PfamPF031069.3E-26385442IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MTTSSSGSVE TSANSRPGTF SFASASFTDL LGGNAGAGGG GVSRYKAMTP PSLPLSPPPV  60
SPSSFFNSPI GMNQADFLGS PVLLTSSIFP SPTTGAFESQ HFDWRPEVAA AQSADQGSKD  120
EQRNSYSDFS FQTAPASEEA ARTTTFQPPV PPAPLGDEAY RSQQQQQPWG YQQQPAGMDA  180
GANAASFGAA PFQATSSEMA PQVQGGGGYS QPQSQRRSSD DGYNWRKYGQ KQVKGSENPR  240
SYYKCTFPNC PTKKKVERSL EGQITEIVYK GTHNHAKPQN TRRNSGSSAA QVLQSGGDMS  300
EHSFGGMSGT AATPENSSAS FGDDEIGVGS PRAGNGGGDE FDDDEPDSKR WRKDGDGEGI  360
SMAGNRTVRE PRVVVQTMSD IDILDDGYRW RKYGQKVVKG NPNPRSYYKC TTAGCPVRKH  420
VERASHDLRA VITTYEGKHN HDVPAARGSA ALYRPAPPAA AATSSHPYLP NQPPPMSYQP  480
TGPQPYALRP DGFGGQGPFG GVVGGSSFGA FSGFDDARGS YMSQHQQQQR QNDAMHASRA  540
KEEPGDDMFF QNSLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-36211445878Probable WRKY transcription factor 4
2lex_A3e-36211445878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6769250.0AY676925.1 Oryza sativa (indica cultivar-group) transcription factor WRKY24 (WRKY24) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619871.10.0PREDICTED: probable WRKY transcription factor 33
TrEMBLA0A0E0A7M80.0A0A0E0A7M8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA004722-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29923687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.13e-96WRKY DNA-binding protein 33